Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNASEH2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-164 of human RNASEH2C (NP_115569.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNASEH2C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-164 of human RNASEH2C (NP_115569.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05967A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNASEH2C |
| Target Synonyms | AGS3; AYP1; RNASEH2C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-164 of human RNASEH2C (NP_115569.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED | Uniprot ID | Q8TDP1 |
Uniprot Id
Q8TDP1
Target Species
Human
Target Name
RNASEH2C
Target Full Name
Ribonuclease H2 subunit C
Target Function
Non catalytic subunit of RNase H2, an endonuclease that specifically degrades the RNA of RNA:DNA hybrids. Participates in DNA replication, possibly by mediating the removal of lagging-strand Okazaki fragment RNA primers during DNA replication. Mediates the excision of single ribonucleotides from DNA:RNA duplexes.
Target Involvement
Aicardi-Goutieres syndrome 3 (AGS3)
Target Subcellular Location
Nucleus.
Target Protein Families
RNase H2 subunit C family
Target Tissue Specificity
Widely expressed.
Target Synonyms
RNASEH2C; AYP1; Ribonuclease H2 subunit C; RNase H2 subunit C; Aicardi-Goutieres syndrome 3 protein; AGS3; RNase H1 small subunit; Ribonuclease HI subunit C
Target Background
This gene encodes a ribonuclease H subunit that can cleave ribonucleotides from RNA:DNA duplexes. Mutations in this gene cause Aicardi-Goutieres syndrome-3, a disease that causes severe neurologic dysfunction. A pseudogene for this gene has been identified on chromosome Y, near the sex determining region Y (SRY) gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
