Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RND3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 145-244 of human RND3 (NP_005159.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RND3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 145-244 of human RND3 (NP_005159.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02000A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RND3 |
| Target Synonyms | ARHE; Rho8; RhoE; memB; RND3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 145-244 of human RND3 (NP_005159.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TLVELSNHRQTPVSYDQGANMAKQIGAATYIECSALQSENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPELSAVATDLRKDKAKSCTVM | Uniprot ID | P61587 |
Uniprot Id
P61587
Target Species
Human
Target Name
RND3
Target Full Name
Rho-related GTP-binding protein RhoE
Target Function
Binds GTP but lacks intrinsic GTPase activity and is resistant to Rho-specific GTPase-activating proteins.
Target Subcellular Location
Golgi apparatus membrane; Peripheral membrane protein.
Target Protein Families
Small GTPase superfamily, Rho family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
ARHE; memB; Protein MemB; Ras homolog gene family member E; Rho family GTPase 3; Rho-related GTP-binding protein Rho8; Rho-related GTP-binding protein RhoE; Rho8; RhoE; Rnd3; RND3_HUMAN; Small GTP binding protein Rho8
Target Background
This gene encodes a protein which is a member of the small GTPase protein superfamily. The encoded protein binds only GTP but has no GTPase activity, and appears to act as a negative regulator of cytoskeletal organization leading to loss of adhesion. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
