Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 660-760 of human RNF10 (NP_055683.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RNF10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 660-760 of human RNF10 (NP_055683.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08251A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF10 |
| Target Synonyms | RNF10; RIE2; RING finger protein 10 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 660-760 of human RNF10 (NP_055683.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | STEGHGALSISPLSRSPGSHADFLLTPLSPTASQGSPSFCVGSLEEDSPFPSFAQMLRVGKAKADVWPKTAPKKDENSLVPPAPVDSDGESDNSDRVPVPS | Uniprot ID | Q8N5U6 |
Uniprot Id
Q8N5U6
Target Species
Human
Target Name
RNF10
Target Full Name
E3 ubiquitin-protein ligase RNF10
Target Function
Transcriptional factor involved in the regulation of MAG (Myelin-associated glycoprotein) expression. Acts as a regulator of Schwann cell differentiation and myelination.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
RNF10 family
Target Synonyms
RNF10; KIAA0262; RIE2; RING finger protein 10
Target Background
The protein encoded by this gene contains a ring finger motif, which is known to be involved in protein-protein interactions. The specific function of this protein has not yet been determined. EST data suggests the existence of multiple alternatively spliced transcript variants, however, their full length nature is not known.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
