-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF125 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF125 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10131A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF125 |
| Target Synonyms | TNORS; TRAC1; TRAC-1; RNF125 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-105 of human RNF125 (NP_060301.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGSVLSTDSGKSAPASATARALERRRDPELPVTSFDCAVCLEVLHQPVRTRCGHVFCRSCIATSLKNNKWTCPYCRAYLPSEGVPATDVAKRMKSEYKNCAECDT | Uniprot ID | Q96EQ8 |
Uniprot Id
Q96EQ8
Target Species
Human
Target Name
RNF125
Target Full Name
E3 ubiquitin-protein ligase RNF125
Target Function
E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins, such as DDX58/RIG-I, MAVS/IPS1, IFIH1/MDA5, JAK1 and p53/TP53. Acts as a negative regulator of type I interferon production by mediating ubiquitination of DDX58/RIG-I at 'Lys-181', leading to DDX58/RIG-I degradation. Mediates ubiquitination and subsequent degradation of p53/TP53. Mediates ubiquitination and subsequent degradation of JAK1. Acts as a positive regulator of T-cell activation.
Target Involvement
Tenorio syndrome (TNORS)
Target Subcellular Location
Golgi apparatus membrane; Lipid-anchor.
Target Tissue Specificity
Predominantly expressed in lymphoid tissues, including bone marrow, spleen and thymus. Also weakly expressed in other tissues. Predominant in the CD4(+) and CD8(+) T-cells, suggesting that it is preferentially confined to T-cells.
Target Research Area
Cell Biology
Target Synonyms
RNF125; E3 ubiquitin-protein ligase RNF125; EC 2.3.2.27; RING finger protein 125; T-cell RING activation protein 1; TRAC-1
Target Background
This gene encodes a novel E3 ubiquitin ligase that contains a RING finger domain in the N-terminus and three zinc-binding and one ubiquitin-interacting motif in the C-terminus. As a result of myristoylation, this protein associates with membranes and is primarily localized to intracellular membrane systems. The encoded protein may function as a positive regulator in the T-cell receptor signaling pathway.
Notification