Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF152 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RNF152 (NP_775828.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF152 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RNF152 (NP_775828.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-08713A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF152 |
| Target Synonyms | RNF152 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, LO2, U-251MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RNF152 (NP_775828.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVI | Uniprot ID | Q8N8N0 |
Uniprot Id
Q8N8N0
Target Species
Human
Target Name
RNF152
Target Full Name
E3 ubiquitin-protein ligase RNF152
Target Function
E3 ubiquitin-protein ligase mediating 'Lys-63'-linked polyubiquitination of RRAGA in response to amino acid starvation. Thereby, regulates mTORC1 signaling and plays a role in the cellular response to amino acid availability. Also mediates 'Lys-48'-linked polyubiquitination of target proteins and their subsequent targeting to the proteasome for degradation. Induces apoptosis when overexpressed.
Target Subcellular Location
Lysosome membrane; Single-pass membrane protein.
Target Protein Families
RNF152 family
Target Tissue Specificity
Widely expressed.
Target Synonyms
RNF152; E3 ubiquitin-protein ligase RNF152; RING finger protein 152; RING-type E3 ubiquitin transferase RNF152
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
