Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF166 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human RNF166 (NP_849163.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF166 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 102-201 of human RNF166 (NP_849163.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06308A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF166 |
| Target Synonyms | RNF166 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, K-562, MCF7, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 102-201 of human RNF166 (NP_849163.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMPWGDPSYKSANFL | Uniprot ID | Q96A37 |
Uniprot Id
Q96A37
Target Species
Human
Target Name
RNF166
Target Full Name
E3 ubiquitin-protein ligase RNF166
Target Function
E3 ubiquitin-protein ligase that promotes the ubiquitination of different substrates. In turn, participates in different biological processes including interferon production or autophagy. Plays a role in the activation of RNA virus-induced interferon-beta production by promoting the ubiquitination of TRAF3 and TRAF6. Plays also a role in the early recruitment of autophagy adapters to bacteria. Mediates 'Lys-29' and 'Lys-33'-linked ubiquitination of SQSTM1 leading to xenophagic targeting of bacteria and inhibition of their replication.
Target Subcellular Location
Cytoplasm.
Target Synonyms
1110031E24Rik; AW555115; MGC14381; MGC2647; RING finger protein 166; RN166_HUMAN; RNF 166; RNF166; Zfp313l; Zinc finger protein 228; Zinc finger protein 313
Target Background
Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in protein polyubiquitination and ubiquitin-dependent protein catabolic process. Predicted to be located in cytoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
