-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF170 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 46-120 of human RNF170 (NP_001153696.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF170 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 46-120 of human RNF170 (NP_001153696.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10127A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF170 |
| Target Synonyms | ADSA; SNAX1; SPG85; RNF170 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse pancreas, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 46-120 of human RNF170 (NP_001153696.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RNVHQNIHPENQELVRVLREQLQTEQDAPAATRQQFYTDMYCPICLHQASFPVETNCGHLFCGACIIAYWRYGSW | Uniprot ID | Q96K19 |
Uniprot Id
Q96K19
Target Species
Human
Target Name
RNF170
Target Full Name
E3 ubiquitin-protein ligase RNF170
Target Function
E3 ubiquitin-protein ligase that plays an essential role in stimulus-induced inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) ubiquitination and degradation via the endoplasmic reticulum-associated degradation (ERAD) pathway. Also involved in ITPR1 turnover in resting cells.
Target Involvement
Ataxia, sensory, 1, autosomal dominant (SNAX1)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Tissue Specificity
Expressed in the spinal chord.
Target Synonyms
RNF170; E3 ubiquitin-protein ligase RNF170; Putative LAG1-interacting protein; RING finger protein 170; RING-type E3 ubiquitin transferase RNF170
Target Background
This gene encodes a RING domain-containing protein that resides in the endoplasmic reticulum (ER) membrane. This protein functions as an E3 ubiquitin ligase and mediates ubiquitination and processing of inositol 1, 4, 5-trisphosphate (IP3) receptors via the ER-associated protein degradation pathway. It is recruited to the activated IP3 receptors by the ERLIN1/ERLIN2 complex to which it is constitutively bound. Mutations in this gene are associated with autosomal dominant sensory ataxia. Alternatively spliced transcript variants have been found for this gene.
Notification