Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNF219 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human RNF219 (NP_078822.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RNF219 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human RNF219 (NP_078822.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06834A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNF219 |
| Target Synonyms | RNF219; C13orf7 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600 to the C-terminus of human RNF219 (NP_078822.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QLENGSEWKPTSFFLLSPSDQEMNEDFSLHSSSCPVTNEIKPPSCLFQTEFSQGILLSSSHRLFEDQRFGSSLFKMSSEMHSLHNHLQSPWSTSFVPEKRNKNVNQSTKRKIQSSLSSASPSKATKS | Uniprot ID | Q5W0B1 |
Uniprot Id
Q5W0B1
Target Species
Human
Target Name
OBI1
Target Full Name
ORC ubiquitin ligase 1
Target Function
E3 ubiquitin ligase essential for DNA replication origin activation during S phase. Acts as a replication origin selector which selects the origins to be fired and catalyzes the multi-mono-ubiquitination of a subset of chromatin-bound ORC3 and ORC5 during S-phase.
Target Subcellular Location
Chromosome.
Target Research Area
Others
Target Synonyms
2610206B13Rik; 2810449K13Rik; AI451544; DKFZp686A01276; DKFZp686N15250; DKFZp686O03173; FLJ13449; FLJ25774; MGC35679; RGD1564706; RING finger protein 219; RING finger protein C13orf7; RN219_HUMAN; RNF219
Target Background
Enables chromatin binding activity and ubiquitin-protein transferase activity. Involved in protein autoubiquitination; protein monoubiquitination; and regulation of DNA replication. Located in chromatin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
