Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ROBO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 848-1007 of human ROBO4 (NP_061928.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ROBO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 848-1007 of human ROBO4 (NP_061928.4) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00885A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ROBO4 |
| Target Synonyms | MRB; AOVD3; ECSM4; ROBO4 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HepG2, HT-1080, HT-29 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 848-1007 of human ROBO4 (NP_061928.4). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GVGPKGGVLLCPPRPCLTPTPSEGSLANGWGSASEDNAASARASLVSSSDGSFLADAHFARALAVAVDSFGFGLEPREADCVFIDASSPPSPRDEIFLTPNLSLPLWEWRPDWLEDMEVSHTQRLGRGMPPWPPDSQISSQRSQLHCRMPKAGASPVDYS | Uniprot ID | Q8WZ75 |
Uniprot Id
Q8WZ75
Target Species
Human
Target Name
ROBO4
Target Full Name
Roundabout homolog 4
Target Function
Receptor for Slit proteins, at least for SLIT2, and seems to be involved in angiogenesis and vascular patterning. May mediate the inhibition of primary endothelial cell migration by Slit proteins. Involved in the maintenance of endothelial barrier organization and function.
Target Protein Families
Immunoglobulin superfamily, ROBO family
Target Tissue Specificity
Specifically expressed in endothelial cells. Expressed in endothelial and intimal cells of the ascending aorta.
Target Synonyms
ECSM4; FLJ20798; Magic roundabout; MGC133352; MGC133353; MRB; Robo 4; ROBO4; ROBO4_HUMAN; Roundabout homolog 4; Roundabout homolog 4 magic roundabout; Roundabout homolog 4 Precursor; Roundabout, axon guidance receptor, homolog 4 (Drosophila)
Target Background
Predicted to enable cell-cell adhesion mediator activity. Involved in angiogenesis and establishment of endothelial barrier. Located in extracellular exosome. Implicated in aortic valve disease 3.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
