Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ROMO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-79 of human ROMO1(NP_542786.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against ROMO1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-79 of human ROMO1(NP_542786.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-08318A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ROMO1 |
| Target Synonyms | MTGM; MTGMP; C20orf52; bA353C18.2; ROMO1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat heart, Hep G2 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-79 of human ROMO1(NP_542786.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC | Uniprot ID | P60602 |
Uniprot Id
P60602
Target Species
Human
Target Name
ROMO1
Target Full Name
Reactive oxygen species modulator 1
Target Function
Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.; Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage.
Target Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Target Protein Families
MGR2 family
Target Tissue Specificity
Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line. Highly expressed in brain tumors.
Target Synonyms
ROMO1; C20orf52; Reactive oxygen species modulator 1; ROS modulator 1; Epididymis tissue protein Li 175; Glyrichin; Mitochondrial targeting GxxxG motif protein; MTGM; Protein MGR2 homolog
Target Background
The protein encoded by this gene is a mitochondrial membrane protein that is responsible for increasing the level of reactive oxygen species (ROS) in cells. The protein also has antimicrobial activity against a variety of bacteria by inducing bacterial membrane breakage.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
