-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPB3/POLR2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPB3/POLR2C (P19387) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RPB3/POLR2C was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPB3/POLR2C (P19387) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14426A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPB3/POLR2C |
| Target Synonyms | RPB3; RPB31; hRPB33; hsRPB3; RPB3/POLR2C | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, Rat lung, Rat spleen | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPB3/POLR2C (P19387). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPYANQPTVRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPLISDDIVDKLQYSRDCTCEEFCPECSVE | Uniprot ID | P19387 |
Uniprot Id
P19387
Target Species
Human
Target Name
POLR2C
Target Full Name
DNA-directed RNA polymerase II subunit RPB3
Target Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB3 is part of the core element with the central large cleft and the clamp element that moves to open and close the cleft.
Target Subcellular Location
Nucleus.
Target Protein Families
Archaeal RpoD/eukaryotic RPB3 RNA polymerase subunit family
Target Synonyms
DNA directed RNA polymerase II 33 kDa polypeptide; DNA directed RNA polymerase II subunit C; DNA directed RNA polymerase II subunit RPB3; DNA-directed RNA polymerase II 33 kDa polypeptide; DNA-directed RNA polymerase II subunit C; DNA-directed RNA polymerase II subunit RPB3; hRPB33; hsRPB3; POLR 2C; POLR2 C; Polr2c; Polymerase (RNA) II (DNA directed) polypeptide C; 33kDa; polymerase RNA II DNA directed polypeptide C 33kDa; RNA polymerase II polypeptide C; RNA polymerase II subunit 3; RNA polymerase II subunit B3; RPB 3; RPB3; RPB3_HUMAN; RPB31; RPB33
Target Background
This gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit, POLR2J. These two subunits form a core subassembly unit of the polymerase. A pseudogene has been identified on chromosome 21.
Notification