-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL13 (NP_150254.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RPL13 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL13 (NP_150254.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13236A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL13 |
| Target Synonyms | L13; BBC1; eL13; D16S44E; SEMDIST; D16S444E; RPL13 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse spleen, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL13 (NP_150254.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAPSRNGMVLKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPASGPIRPIVRCPTVRYHTKVRAGRGFSLEELRVAGIHKKVARTIGISVDP | Uniprot ID | P26373 |
Uniprot Id
P26373
Target Species
Human
Target Name
RPL13
Target Full Name
Large ribosomal subunit protein eL13
Target Function
Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules (Probable). The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain (Probable). The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel (Probable). As part of the LSU, it is probably required for its formation and the maturation of rRNAs. Plays a role in bone development.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Eukaryotic ribosomal protein eL13 family
Target Tissue Specificity
Higher levels of expression in benign breast lesions than in carcinomas.
Target Synonyms
60S ribosomal protein L13; BBC1; Breast basic conserved gene 1; Breast basic conserved protein 1; D16S444E ; D16S44E; FLJ27453 ; FLJ27454 ; L13; MGC117342 ; MGC71373 ; OK/SW cl.46; OK/SWcl.46; Ribosomal protein L13; RL13_HUMAN; rpl13
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L13E family of ribosomal proteins. It is located in the cytoplasm. This gene is expressed at significantly higher levels in benign breast lesions than in breast carcinomas. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Notification