Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL28 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL28 (NP_000982.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RPL28 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL28 (NP_000982.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05277A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL28 |
| Target Synonyms | L28; eL28; RPL28 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, DU145, HT-29, Mouse liver, Rat spleen | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RPL28 (NP_000982.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKN | Uniprot ID | P46779 |
Uniprot Id
P46779
Target Species
Human
Target Name
RPL28
Target Full Name
Large ribosomal subunit protein eL28
Target Function
Component of the large ribosomal subunit.
Target Protein Families
Eukaryotic ribosomal protein eL28 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
60S ribosomal protein L28; FLJ 43307 ; FLJ43307 ; L 28; L28; Ribosomal protein L28 ; RL28_HUMAN; RPL 28 ; rpl28
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L28E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
