-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPL7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human RPL7A (P62424) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPL7A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human RPL7A (P62424) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14370A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPL7A |
| Target Synonyms | L7A; eL8; TRUP; SURF3; PLA-X polypeptide; RPL7A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, 293T, Hep G2, Mouse liver, Mouse lung, PC-12, Raji, Rat liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-165 of human RPL7A (P62424). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQLVVIAHDVDPIE | Uniprot ID | P62424 |
Uniprot Id
P62424
Target Species
Human
Target Name
RPL7A
Target Full Name
Large ribosomal subunit protein eL8
Target Involvement
Chromosomal recombination involving RPL7A activates the receptor kinase domain of the TRK oncogene.
Target Protein Families
Eukaryotic ribosomal protein eL8 family
Target Synonyms
60S ribosomal protein L7a; L7A; MGC103146; PLA X polypeptide ; PLA-X polypeptide; ribosomal protein L7a; RL7A_HUMAN; RP23-414L19.4; RPL7A; SURF 3; SURF-3; SURF3 ; surfeit 3; Surfeit locus protein 3; Thyroid hormone receptor uncoupling protein; TRUP
Target Background
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L7AE family of ribosomal proteins. It can interact with a subclass of nuclear hormone receptors, including thyroid hormone receptor, and inhibit their ability to transactivate by preventing their binding to their DNA response elements. This gene is included in the surfeit gene cluster, a group of very tightly linked genes that do not share sequence similarity. It is co-transcribed with the U24, U36a, U36b, and U36c small nucleolar RNA genes, which are located in its second, fifth, fourth, and sixth introns, respectively. This gene rearranges with the trk proto-oncogene to form the chimeric oncogene trk-2h, which encodes an oncoprotein consisting of the N terminus of ribosomal protein L7a fused to the receptor tyrosine kinase domain of trk. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Notification