Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPLP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human RPLP2 (NP_000995.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
The antibody against RPLP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human RPLP2 (NP_000995.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, IF/ICC, ELISA.
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma using RPLP2 Rabbit pAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
| Cat.No | ADA-02763A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPLP2 |
| Target Synonyms | P2; LP2; RPP2; D11S2243E; RPLP2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-115 of human RPLP2 (NP_000995.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD | Uniprot ID | P05387 |
Uniprot Id
P05387
Target Species
Human
Target Name
RPLP2
Target Full Name
Large ribosomal subunit protein P2
Target Function
Plays an important role in the elongation step of protein synthesis.
Target Protein Families
Eukaryotic ribosomal protein P1/P2 family
Target Research Area
Cancer, Epigenetics and Nuclear Signaling
Target Synonyms
2700049I22Rik; 60S acidic ribosomal protein P2; Acidic ribosomal phosphoprotein P2; D11S2243E; LP2; MGC71408; OTTMUSP00000029428; OTTMUSP00000029429; OTTMUSP00000029430; P2; Renal carcinoma antigen NY-REN-44; Ribosomal protein P2; Ribosomal protein, large, P2; RLA2_HUMAN; rplP2; RPP2
Target Background
Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal phosphoprotein that is a component of the 60S subunit. The protein, which is a functional equivalent of the E. coli L7/L12 ribosomal protein, belongs to the L12P family of ribosomal proteins. It plays an important role in the elongation step of protein synthesis. Unlike most ribosomal proteins, which are basic, the encoded protein is acidic. Its C-terminal end is nearly identical to the C-terminal ends of the ribosomal phosphoproteins P0 and P1. The P2 protein can interact with P0 and P1 to form a pentameric complex consisting of P1 and P2 dimers, and a P0 monomer. The protein is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
