-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-540 of human RPN2 (NP_002942.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPN2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 360-540 of human RPN2 (NP_002942.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11720A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPN2 |
| Target Synonyms | SWP1; RPNII; RIBIIR; RPN-II; RPN2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | NIH/3T3, 293T, HepG2, Jurkat, MCF7, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 360-540 of human RPN2 (NP_002942.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV | Uniprot ID | P04844 |
Uniprot Id
P04844
Target Species
Human
Target Name
RPN2
Target Full Name
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
Target Function
Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity.
Target Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
SWP1 family
Target Tissue Specificity
Expressed in all tissues tested.
Target Synonyms
RPN2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; RIBIIR; Ribophorin II; RPN-II; Ribophorin-2
Target Background
This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein is similar in sequence to the yeast oligosaccharyl transferase subunit SWP1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification