Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPP40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human RPP40 (NP_001273061) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPP40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human RPP40 (NP_001273061) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05855A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPP40 |
| Target Synonyms | RNASEP1; bA428J1.3; RPP40 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Mouse liver, Mouse testis, Rat lung, Rat thymus, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human RPP40 (NP_001273061). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEV | Uniprot ID | O75818 |
Uniprot Id
O75818
Target Species
Human
Target Name
RPP40
Target Full Name
Ribonuclease P protein subunit p40
Target Function
Component of ribonuclease P, a ribonucleoprotein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of the MRP ribonuclease complex, which cleaves pre-rRNA sequences.
Target Subcellular Location
Nucleus, nucleolus.
Target Synonyms
EC 3.1.26.5; Ribonuclease P protein subunit p40; RNase P subunit 1; RNaseP protein p40; RNASEP1; RPP40; RPP40_HUMAN
Target Background
Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Part of multimeric ribonuclease P complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
