-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPS4X was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 66-263 of human RPS4X (NP_000998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPS4X was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 66-263 of human RPS4X (NP_000998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-11080A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPS4X |
| Target Synonyms | S4; eS4; CCG2; RPS4; SCAR; SCR10; DXS306; RPS4X | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse brain, Mouse spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 66-263 of human RPS4X (NP_000998.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MQRFIKIDGKVRTDITYPAGFMDVISIDKTGENFRLIYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPDPLIKVNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEERDKRLAAKQSSG | Uniprot ID | P62701 |
Uniprot Id
P62701
Target Species
Human
Target Name
RPS4X
Target Full Name
Small ribosomal subunit protein eS4, X isoform
Target Subcellular Location
Cytoplasm. Note=Localized in cytoplasmic mRNP granules containing untranslated mRNAs.
Target Protein Families
Eukaryotic ribosomal protein eS4 family
Target Synonyms
40S ribosomal protein S4; CCG2; Cell cycle gene 2; DXS306; FLJ40595; ribosomal protein S4; X-linked; Ribosomal protein S4X isoform; RPS4; rps4x; RS4X_HUMAN; S4; SCAR; SCR10; Single copy abundant mRNA protein; Single-copy abundant mRNA; X isoform
Target Background
Cytoplasmic ribosomes, organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes ribosomal protein S4, a component of the 40S subunit. Ribosomal protein S4 is the only ribosomal protein known to be encoded by more than one gene, namely this gene and ribosomal protein S4, Y-linked (RPS4Y). The 2 isoforms encoded by these genes are not identical, but are functionally equivalent. Ribosomal protein S4 belongs to the S4E family of ribosomal proteins. This gene is not subject to X-inactivation. It has been suggested that haploinsufficiency of the ribosomal protein S4 genes plays a role in Turner syndrome; however, this hypothesis is controversial. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Notification