Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RPS6KA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 646-745 of human RPS6KA6 (NP_055311.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RPS6KA6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 646-745 of human RPS6KA6 (NP_055311.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05406A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RPS6KA6 |
| Target Synonyms | RSK4; RSK-4; p90RSK6; PP90RSK4; S6K-alpha-6; RPS6KA6 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 646-745 of human RPS6KA6 (NP_055311.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL | Uniprot ID | Q9UK32 |
Uniprot Id
Q9UK32
Target Species
Human
Target Name
RPS6KA6
Target Full Name
Ribosomal protein S6 kinase alpha-6
Target Function
Constitutively active serine/threonine-protein kinase that exhibits growth-factor-independent kinase activity and that may participate in p53/TP53-dependent cell growth arrest signaling and play an inhibitory role during embryogenesis.
Target Subcellular Location
Cytoplasm, cytosol. Nucleus. Note=Predominantly cytosolic.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily
Target Synonyms
90 kDa ribosomal protein S6 kinase 6; KS6A6_HUMAN; p90 RSK 6; p90-RSK 6; p90RSK6; pp90RSK4; Ribosomal protein S6 kinase 90kDa polypeptide 6; Ribosomal protein S6 kinase alpha 6; Ribosomal protein S6 kinase alpha-6; Ribosomal S6 kinase 4; rps6ka6; RSK 4; RSK-4; S6K-alpha-6
Target Background
This gene encodes a member of ribosomal S6 kinase family, serine-threonine protein kinases which are regulated by growth factors. The encoded protein may be distinct from other members of this family, however, as studies suggest it is not growth factor dependent and may not participate in the same signaling pathways.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
