-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RRAGA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 213-313 of human RRAGA (NP_006561.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RRAGA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 213-313 of human RRAGA (NP_006561.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01954A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RRAGA |
| Target Synonyms | FIP1; RAGA; FIP-1; RRAGA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, 293T, HepG2, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 213-313 of human RRAGA (NP_006561.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VISHYQCKEQRDVHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFTSNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKHSLLMR | Uniprot ID | Q7L523 |
Uniprot Id
Q7L523
Target Species
Human
Target Name
RRAGA
Target Full Name
Ras-related GTP-binding protein A
Target Function
Guanine nucleotide-binding protein that plays a crucial role in the cellular response to amino acid availability through regulation of the mTORC1 signaling cascade. Forms heterodimeric Rag complexes with RRAGC or RRAGD and cycles between an inactive GDP-bound and an active GTP-bound form. In its active form participates in the relocalization of mTORC1 to the lysosomes and its subsequent activation by the GTPase RHEB. Involved in the RCC1/Ran-GTPase pathway. May play a direct role in a TNF-alpha signaling pathway leading to induction of cell death.; (Microbial infection) May alternatively act as a cellular target for adenovirus E3-14.7K, an inhibitor of TNF-alpha functions, thereby affecting cell death.
Target Subcellular Location
Cytoplasm. Nucleus. Lysosome.
Target Protein Families
GTR/RAG GTP-binding protein family
Target Tissue Specificity
Ubiquitously expressed with highest levels of expression in skeletal muscle, heart, and brain.
Target Research Area
Apoptosis
Target Synonyms
Adenovirus E3 14.7 kDa-interacting protein 1; FIP-1; Rag A; RagA; Ras-related GTP-binding protein A; RRAGA; RRAGA_HUMAN
Target Background
Enables several functions, including GTP binding activity; protein dimerization activity; and ubiquitin protein ligase binding activity. Involved in several processes, including cellular response to amino acid starvation; negative regulation of autophagy; and positive regulation of TORC1 signaling. Located in lysosome and nucleus. Colocalizes with GATOR1 complex.
Notification