Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RRN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-651 of human RRN3 (NP_060897.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RRN3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 550-651 of human RRN3 (NP_060897.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01570A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RRN3 |
| Target Synonyms | TIFIA; A-270G1.2; RRN3 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse brain, Mouse liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 550-651 of human RRN3 (NP_060897.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QICTNPLDTFFPFDPCVLKRSKKFIDPIYQVWEDMSAEELQEFKKPMKKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSVGSPPVLYMQPSPL | Uniprot ID | Q9NYV6 |
Uniprot Id
Q9NYV6
Target Species
Human
Target Name
RRN3
Target Full Name
RNA polymerase I-specific transcription initiation factor RRN3
Target Function
Required for efficient transcription initiation by RNA polymerase I. Required for the formation of the competent preinitiation complex (PIC). Dissociates from pol I as a consequence of transcription. In vitro, cannot activate transcription in a subsequent transcription reaction.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
RRN3 family
Target Synonyms
AL023001; DKFZp566E104; E130302O19Rik; MGC104238; R75565; RGD1305001; RNA polymerase I-specific transcription initiation factor RRN3; Rrn3; RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae); RRN3_HUMAN; TIF-IA; TIF1A; TIFIA; Transcription Initiation Factor 1A; Transcription initiation factor IA; Transcription initiation factor TIF IA
Target Background
Enables RNA polymerase I core promoter sequence-specific DNA binding activity. Predicted to be involved in transcription initiation from RNA polymerase I promoter. Predicted to act upstream of or within several processes, including DNA-templated transcription, initiation; negative regulation of intrinsic apoptotic signaling pathway by p53 class mediator; and regulation of transcription, DNA-templated. Located in nucleolus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
