-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RSK2 / RPS6KA3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human RSK2 / RPS6KA3 (P51812) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RSK2 / RPS6KA3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human RSK2 / RPS6KA3 (P51812) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14511A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RSK2 / RPS6KA3 |
| Target Synonyms | CLS; RSK; HU-3; RSK2; MRX19; ISPK-1; XLID19; p90-RSK2; pp90RSK2; MAPKAPK1B; S6K-alpha3; RSK2 / RPS6KA3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human RSK2 / RPS6KA3 (P51812). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVK | Uniprot ID | P51812 |
Uniprot Id
P51812
Target Species
Human
Target Name
RPS6KA3
Target Full Name
Ribosomal protein S6 kinase alpha-3
Target Function
Serine/threonine-protein kinase that acts downstream of ERK (MAPK1/ERK2 and MAPK3/ERK1) signaling and mediates mitogenic and stress-induced activation of the transcription factors CREB1, ETV1/ER81 and NR4A1/NUR77, regulates translation through RPS6 and EIF4B phosphorylation, and mediates cellular proliferation, survival, and differentiation by modulating mTOR signaling and repressing pro-apoptotic function of BAD and DAPK1. In fibroblast, is required for EGF-stimulated phosphorylation of CREB1 and histone H3 at 'Ser-10', which results in the subsequent transcriptional activation of several immediate-early genes. In response to mitogenic stimulation (EGF and PMA), phosphorylates and activates NR4A1/NUR77 and ETV1/ER81 transcription factors and the cofactor CREBBP. Upon insulin-derived signal, acts indirectly on the transcription regulation of several genes by phosphorylating GSK3B at 'Ser-9' and inhibiting its activity. Phosphorylates RPS6 in response to serum or EGF via an mTOR-independent mechanism and promotes translation initiation by facilitating assembly of the preinitiation complex. In response to insulin, phosphorylates EIF4B, enhancing EIF4B affinity for the EIF3 complex and stimulating cap-dependent translation. Is involved in the mTOR nutrient-sensing pathway by directly phosphorylating TSC2 at 'Ser-1798', which potently inhibits TSC2 ability to suppress mTOR signaling, and mediates phosphorylation of RPTOR, which regulates mTORC1 activity and may promote rapamycin-sensitive signaling independently of the PI3K/AKT pathway. Mediates cell survival by phosphorylating the pro-apoptotic proteins BAD and DAPK1 and suppressing their pro-apoptotic function. Promotes the survival of hepatic stellate cells by phosphorylating CEBPB in response to the hepatotoxin carbon tetrachloride (CCl4). Is involved in cell cycle regulation by phosphorylating the CDK inhibitor CDKN1B, which promotes CDKN1B association with 14-3-3 proteins and prevents its translocation to the nucleus and inhibition of G1 progression. In LPS-stimulated dendritic cells, is involved in TLR4-induced macropinocytosis, and in myeloma cells, acts as effector of FGFR3-mediated transformation signaling, after direct phosphorylation at Tyr-529 by FGFR3. Negatively regulates EGF-induced MAPK1/3 phosphorylation via phosphorylation of SOS1. Phosphorylates SOS1 at 'Ser-1134' and 'Ser-1161' that create YWHAB and YWHAE binding sites and which contribute to the negative regulation of MAPK1/3 phosphorylation. Phosphorylates EPHA2 at 'Ser-897', the RPS6KA-EPHA2 signaling pathway controls cell migration. Acts as a regulator of osteoblast differentiation by mediating phosphorylation of ATF4, thereby promoting ATF4 transactivation activity.
Target Involvement
Coffin-Lowry syndrome (CLS); Mental retardation, X-linked 19 (MRX19)
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Protein kinase superfamily, AGC Ser/Thr protein kinase family, S6 kinase subfamily
Target Tissue Specificity
Expressed in many tissues, highest levels in skeletal muscle.
Target Synonyms
90 kDa ribosomal protein S6 kinase 3; CLS; HU 3; HU2; HU3; Insulin stimulated protein kinase 1; Insulin-stimulated protein kinase 1; ISPK-1; ISPK1; KS6A3_HUMAN; MAP kinase activated protein kinase 1b; MAP kinase-activated protein kinase 1b; MAPK activated protein kinase 1b; MAPK-activated protein kinase 1b; MAPKAP kinase 1b; MAPKAPK 1b; MAPKAPK-1b; MAPKAPK1B; Mental retardation; X linked 19; MRX19; OTTHUMP00000023036; p90 RSK2; p90 RSK3 ; p90-RSK 3; p90RSK3; pp90RSK2; Ribosomal protein S6 kinase 90kDa polypeptide 3; Ribosomal protein S6 kinase alpha 3; Ribosomal protein S6 kinase alpha-3; Ribosomal protein s6 kinase ii alpha 2 ; Ribosomal S6 kinase 2; Rps6ka3; RSK; RSK-2; RSK2; S6 kinase 2; S6K alpha3; S6K-alpha-3
Target Background
This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates various substrates, including members of the mitogen-activated kinase (MAPK) signalling pathway. The activity of this protein has been implicated in controlling cell growth and differentiation. Mutations in this gene have been associated with Coffin-Lowry syndrome (CLS).
Notification