Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RSL24D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RSL24D1 (NP_057388.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RSL24D1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RSL24D1 (NP_057388.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07029A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RSL24D1 |
| Target Synonyms | L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso; RSL24D1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Mouse spleen, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 10-80 of human RSL24D1 (NP_057388.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIK | Uniprot ID | Q9UHA3 |
Uniprot Id
Q9UHA3
Target Species
Human
Target Name
RSL24D1
Target Full Name
Probable ribosome biogenesis protein RLP24
Target Function
Involved in the biogenesis of the 60S ribosomal subunit. Ensures the docking of GTPBP4/NOG1 to pre-60S particles.
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
Eukaryotic ribosomal protein eL24 family
Target Synonyms
RSL24D1; C15orf15; RPL24L; My024; Probable ribosome biogenesis protein RLP24; Ribosomal L24 domain-containing protein 1; Ribosomal protein L24-like
Target Background
This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
