-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RUNX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-260 of human RUNX1 (NP_001001890.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RUNX1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 171-260 of human RUNX1 (NP_001001890.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-08810A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RUNX1 |
| Target Synonyms | AML1; CBFA2; EVI-1; AMLCR1; PEBP2aB; CBF2alpha; AML1-EVI-1; PEBP2alpha; RUNX1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Molt-4 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 171-260 of human RUNX1 (NP_001001890.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGPREPRRHRQKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSPPWSYDQSYQY | Uniprot ID | Q01196 |
Uniprot Id
Q01196
Target Species
Human
Target Name
RUNX1
Target Full Name
Runt-related transcription factor 1
Target Function
Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'-TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX. The heterodimers bind to the core site of a number of enhancers and promoters, including murine leukemia virus, polyomavirus enhancer, T-cell receptor enhancers, LCK, IL3 and GM-CSF promoters. Essential for the development of normal hematopoiesis. Acts synergistically with ELF4 to transactivate the IL-3 promoter and with ELF2 to transactivate the BLK promoter. Inhibits KAT6B-dependent transcriptional activation. Involved in lineage commitment of immature T cell precursors. CBF complexes repress ZBTB7B transcription factor during cytotoxic (CD8+) T cell development. They bind to RUNX-binding sequence within the ZBTB7B locus acting as transcriptional silencer and allowing for cytotoxic T cell differentiation. CBF complexes binding to the transcriptional silencer is essential for recruitment of nuclear protein complexes that catalyze epigenetic modifications to establish epigenetic ZBTB7B silencing. Controls the anergy and suppressive function of regulatory T-cells (Treg) by associating with FOXP3. Activates the expression of IL2 and IFNG and down-regulates the expression of TNFRSF18, IL2RA and CTLA4, in conventional T-cells. Positively regulates the expression of RORC in T-helper 17 cells.; Isoform AML-1G shows higher binding activities for target genes and binds TCR-beta-E2 and RAG-1 target site with threefold higher affinity than other isoforms. It is less effective in the context of neutrophil terminal differentiation.; Isoform AML-1L interferes with the transactivation activity of RUNX1.
Target Involvement
Familial platelet disorder with associated myeloid malignancy (FPDMM)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in all tissues examined except brain and heart. Highest levels in thymus, bone marrow and peripheral blood.
Target Research Area
Cancer
Target Synonyms
Acute myeloid leukemia 1; Acute myeloid leukemia 1 protein; alpha subunit core binding factor; AML 1; AML1; AML1 EVI 1; AML1 EVI 1 fusion protein; Aml1 oncogene; AMLCR 1; AMLCR1; CBF alpha 2; CBF-alpha-2; CBFA 2; CBFA2; Core binding factor alpha 2 subunit; Core binding factor runt domain alpha subunit 2; Core-binding factor subunit alpha-2; EVI 1; EVI1; HGNC; Oncogene AML 1; Oncogene AML-1; OTTHUMP00000108696; OTTHUMP00000108697; OTTHUMP00000108699; OTTHUMP00000108700; OTTHUMP00000108702; PEA2 alpha B; PEA2-alpha B; PEBP2 alpha B; PEBP2-alpha B; PEBP2A2; PEBP2aB; Polyomavirus enhancer binding protein 2 alpha B subunit; Polyomavirus enhancer-binding protein 2 alpha B subunit; Run1; Runt related transcription factor 1; Runt-related transcription factor 1; RUNX 1; Runx1; RUNX1_HUMAN; SL3 3 enhancer factor 1 alpha B subunit; SL3-3 enhancer factor 1 alpha B subunit; SL3/AKV core binding factor alpha B subunit; SL3/AKV core-binding factor alpha B subunit
Target Background
Core binding factor (CBF) is a heterodimeric transcription factor that binds to the core element of many enhancers and promoters. The protein encoded by this gene represents the alpha subunit of CBF and is thought to be involved in the development of normal hematopoiesis. Chromosomal translocations involving this gene are well-documented and have been associated with several types of leukemia. Three transcript variants encoding different isoforms have been found for this gene.
Notification