-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RUNX1T1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-403 of human RUNX1T1 (NP_783552.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RUNX1T1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 250-403 of human RUNX1T1 (NP_783552.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04522A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RUNX1T1 |
| Target Synonyms | CDR; ETO; MTG8; AML1T1; ZMYND2; CBFA2T1; AML1-MTG8; RUNX1T1 | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 250-403 of human RUNX1T1 (NP_783552.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENGFDREPLHSEHPSKRPCTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRNRPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADREELNYWIRRYSDAEDLK | Uniprot ID | Q06455 |
Uniprot Id
Q06455
Target Species
Human
Target Name
RUNX1T1
Target Full Name
Protein CBFA2T1
Target Function
Transcriptional corepressor which facilitates transcriptional repression via its association with DNA-binding transcription factors and recruitment of other corepressors and histone-modifying enzymes. Can repress the expression of MMP7 in a ZBTB33-dependent manner. Can repress transactivation mediated by TCF12. Acts as a negative regulator of adipogenesis. The AML1-MTG8/ETO fusion protein frequently found in leukemic cells is involved in leukemogenesis and contributes to hematopoietic stem/progenitor cell self-renewal.
Target Involvement
A chromosomal aberration involving RUNX1T1 is a cause of acute myeloid leukemia (AML-M2). Translocation t(8;21)(q22;q22) with RUNX1/AML1.
Target Subcellular Location
Nucleus. Note=Colocalizes with ATN1 in discrete nuclear dots.
Target Protein Families
CBFA2T family
Target Tissue Specificity
Most abundantly expressed in brain. Lower levels in lung, heart, testis and ovary.
Target Research Area
Cancer
Target Synonyms
Cyclin-D-related protein (Eight twenty one protein) (Protein ETO) (Protein MTG8) (Zinc finger MYND domain-containing protein 2)
Target Background
This gene encodes a member of the myeloid translocation gene family which interact with DNA-bound transcription factors and recruit a range of corepressors to facilitate transcriptional repression. The t(8;21)(q22;q22) translocation is one of the most frequent karyotypic abnormalities in acute myeloid leukemia. The translocation produces a chimeric gene made up of the 5'-region of the runt-related transcription factor 1 gene fused to the 3'-region of this gene. The chimeric protein is thought to associate with the nuclear corepressor/histone deacetylase complex to block hematopoietic differentiation. Alternative splicing results in multiple transcript variants.
Notification