Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RWDD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human RWDD1 (NP_057036.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RWDD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human RWDD1 (NP_057036.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01020A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RWDD1 |
| Target Synonyms | CGI-24; PTD013; RWDD1 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse liver, Mouse pancreas, Rat thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human RWDD1 (NP_057036.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTDYGEEQRNELEALESIYPDSFTVLSENPPSFTITVTSEAGENDETVQTTLKFTYSEKYPDEAPLYEIFSQENLEDNDVSDILKLLALQ | Uniprot ID | Q9H446 |
Uniprot Id
Q9H446
Target Species
Human
Target Name
RWDD1
Target Full Name
RWD domain-containing protein 1
Target Function
Protects DRG2 from proteolytic degradation.
Target Protein Families
RWDD1/GIR2 family
Target Synonyms
CGI 24; DFRP2; DRG family regulatory protein 2 ; DRG family-regulatory protein 2; PTD013; RWD domain containing 1; RWD domain containing protein 1; RWD domain-containing protein 1; Rwdd1; RWDD1_HUMAN
Target Background
Predicted to be involved in several processes, including cellular response to lipid; cytoplasmic translation; and positive regulation of androgen receptor activity. Predicted to be located in cytoplasm. Predicted to be part of polysome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
