Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RXFP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 673-757 of human RXFP1 (NP_067647.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RXFP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 673-757 of human RXFP1 (NP_067647.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02668A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RXFP1 |
| Target Synonyms | LGR7; RXFPR1; RXFP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Mouse brain, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 673-757 of human RXFP1 (NP_067647.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLFTYPCEMSLISQSTRLNSYS | Uniprot ID | Q9HBX9 |
Uniprot Id
Q9HBX9
Target Species
Human
Target Name
RXFP1
Target Full Name
Relaxin receptor 1
Target Function
Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.
Target Synonyms
RXFP1; LGR7; Relaxin receptor 1; Leucine-rich repeat-containing G-protein coupled receptor 7; Relaxin family peptide receptor 1
Target Background
This gene encodes a member of the leucine-rich repeat-containing subgroup of the G protein-coupled 7-transmembrane receptor superfamily. The encoded protein plays a critical role in sperm motility, pregnancy and parturition as a receptor for the protein hormone relaxin. Decreased expression of this gene may play a role in endometriosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
