-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RXRG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human RXRG (NP_008848.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RXRG was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human RXRG (NP_008848.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-00544A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RXRG |
| Target Synonyms | RXRC; NR2B3; RXRgamma; RXR-gamma; RXRG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, DU145, Jurkat, Mouse brain, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-137 of human RXRG (NP_008848.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKH | Uniprot ID | P48443 |
Uniprot Id
P48443
Target Species
Human
Target Name
RXRG
Target Full Name
Retinoic acid receptor RXR-gamma
Target Function
Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. The high affinity ligand for RXRs is 9-cis retinoic acid.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Nuclear hormone receptor family, NR2 subfamily
Target Tissue Specificity
Expressed in aortic endothelial cells (at protein level).
Target Synonyms
MGC109416; NR2B3; Nuclear receptor subfamily 2 group B member 3; OTTHUMP00000060418; Retanoic X receptor gamma; Retinoic acid receptor RXR gamma; Retinoic acid receptor RXR-gamma; Retinoid X receptor gamma; RXR G; RXR gamma; RXRC; Rxrg; RXRG_HUMAN; RXRgamma
Target Background
This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternatively spliced transcript variants have been described.
Notification