-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RYR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 4868-4967 of human RYR2 (NP_001026.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RYR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 4868-4967 of human RYR2 (NP_001026.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-12670A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RYR2 |
| Target Synonyms | RyR; ARVC2; ARVD2; RYR-2; VTSIP; VACRDS; RYR2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 4868-4967 of human RYR2 (NP_001026.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DAFGELRDQQEQVKEDMETKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWEFFPAGDCFRKQYEDQLN | Uniprot ID | Q92736 |
Uniprot Id
Q92736
Target Species
Human
Target Name
RYR2
Target Full Name
Ryanodine receptor 2
Target Function
Calcium channel that mediates the release of Ca(2+) from the sarcoplasmic reticulum into the cytoplasm and thereby plays a key role in triggering cardiac muscle contraction. Aberrant channel activation can lead to cardiac arrhythmia. In cardiac myocytes, calcium release is triggered by increased Ca(2+) levels due to activation of the L-type calcium channel CACNA1C. The calcium channel activity is modulated by formation of heterotetramers with RYR3. Required for cellular calcium ion homeostasis. Required for embryonic heart development.
Target Involvement
Arrhythmogenic right ventricular dysplasia, familial, 2 (ARVD2); Ventricular tachycardia, catecholaminergic polymorphic, 1, with or without atrial dysfunction and/or dilated cardiomyopathy (CPVT1)
Target Subcellular Location
Sarcoplasmic reticulum membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein. Sarcoplasmic reticulum.
Target Protein Families
Ryanodine receptor (TC 1.A.3.1) family, RYR2 subfamily
Target Tissue Specificity
Detected in heart muscle (at protein level). Heart muscle, brain (cerebellum and hippocampus) and placenta.
Target Synonyms
ARVC2; ARVD2; Cardiac muscle ryanodine receptor; Cardiac muscle ryanodine receptor-calcium release channel; hRYR-2; ryanodine receptor 2 (cardiac); Ryanodine receptor 2; RyR; RYR-2; RyR2; RYR2_HUMAN; Type 2 ryanodine receptor; VTSIP
Target Background
This gene encodes a ryanodine receptor found in cardiac muscle sarcoplasmic reticulum. The encoded protein is one of the components of a calcium channel, composed of a tetramer of the ryanodine receptor proteins and a tetramer of FK506 binding protein 1B proteins, that supplies calcium to cardiac muscle. Mutations in this gene are associated with stress-induced polymorphic ventricular tachycardia and arrhythmogenic right ventricular dysplasia.
Notification