-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-97 of human S100A10 (P60903) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against S100A10 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-97 of human S100A10 (P60903) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16023A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A10 |
| Target Synonyms | 42C; P11; p10; GP11; ANX2L; CAL1L; CLP11; Ca[1]; ANX2LG; S100A10 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-97 of human S100A10 (P60903). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK | Uniprot ID | P60903 |
Uniprot Id
P60903
Target Species
Human
Target Name
S100A10
Target Full Name
Protein S100-A10
Target Function
Because S100A10 induces the dimerization of ANXA2/p36, it may function as a regulator of protein phosphorylation in that the ANXA2 monomer is the preferred target (in vitro) of tyrosine-specific kinase.
Target Protein Families
S-100 family
Target Research Area
Signal Transduction
Target Synonyms
42C; AA409961; AL024248; Annexin II ligand; Annexin II ligand; calpactin I; light polypeptide ; Annexin II tetramer (AIIt) p11 subunit; Annexin II; light chain; ANX2L ; ANX2LG ; Ca[1] ; CAL12; CAL1L ; Calpactin I light chain; Calpactin I; p11 subunit; Calpactin-1 light chain; Cellular ligand of annexin II; CLP11 ; GP11 ; MGC111133 ; Nerve growth factor-induced protein 42C; OTTHUMP00000015269 ; OTTHUMP00000015270 ; p10 ; p10 protein; p11; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10 (annexin II ligand; calpactin I; light polypeptide (p11)) ; S100 calcium binding protein A10 (calpactin); S100 calcium binding protein A10; S100 calcium-binding protein A10; S100a10; S10AA_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in exocytosis and endocytosis.
Notification