-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human S100A16 (NP_525127.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against S100A16 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human S100A16 (NP_525127.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00556A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A16 |
| Target Synonyms | AAG13; S100F; DT1P1A7; S100A16 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-3, SK-BR-3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-103 of human S100A16 (NP_525127.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSDCYTELEKAVIVLVENFYKYVSKYSLVKNKISKSSFREMLQKELNHMLSDTGNRKAADKLIQNLDANHDGRISFDEYWTLIGGITGPIAKLIHEQEQQSSS | Uniprot ID | Q96FQ6 |
Uniprot Id
Q96FQ6
Target Species
Human
Target Name
S100A16
Target Full Name
Protein S100-A16
Target Function
Calcium-binding protein. Binds one calcium ion per monomer. Can promote differentiation of adipocytes (in vitro). Overexpression in preadipocytes increases their proliferation, enhances adipogenesis and reduces insulin-stimulated glucose uptake.
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Note=Primarily nucleolar. A high intracellular calcium level induces nucleolar exit and nucleocytoplasmic transport, whereas a low intracellular calcium level leads to nuclear translocation and accumulation within specific region of nucleoli (PubMed:17030513).
Target Protein Families
S-100 family
Target Tissue Specificity
Ubiquitous. Highly expressed in esophagus, adipose tissues and colon. Expressed at lower level in lung, brain, pancreas and skeletal muscle. Expression is up-regulated in tumors of bladder, lung, thyroid gland, pancreas and ovary. Expressed in astrocytes.
Target Synonyms
2300002L21Rik; AAG13; Aging associated gene 13 protein; Aging associated protein 13; Aging-associated gene 13 protein; AI325039; AI663996; DT1P1A7; MGC17528; Protein S100 A16; Protein S100-A16; Protein S100-F; Protein S100F; S100 calcium binding protein A16; S100 calcium-binding protein A16; S100A16; S100F; S10AG_HUMAN
Target Background
Enables calcium ion binding activity and protein homodimerization activity. Predicted to act upstream of or within response to calcium ion. Located in several cellular components, including cytosol; extracellular space; and nucleolus.
Notification