Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A3 (NP_002951.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against S100A3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A3 (NP_002951.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04008A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A3 |
| Target Synonyms | S100E; S100A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, SKOV3 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human S100A3 (NP_002951.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ | Uniprot ID | P33764 |
Uniprot Id
P33764
Target Species
Human
Target Name
S100A3
Target Full Name
Protein S100-A3
Target Function
Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.
Target Subcellular Location
Cytoplasm.
Target Protein Families
S-100 family
Target Tissue Specificity
Skin specific, specifically expressed at the inner endocuticle of hair fibers.
Target Research Area
Signal Transduction
Target Synonyms
Protein S 100E; Protein S-100E; Protein S100 A3; Protein S100-A3; S100 calcium binding protein A3; S100 calcium-binding protein A3; S100a3; S100E; S10A3_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein has the highest content of cysteines of all S100 proteins, has a high affinity for Zinc, and is highly expressed in human hair cuticle. The precise function of this protein is unknown.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
