-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S100A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (NP_055439.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against S100A6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (NP_055439.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-13169A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S100A6 |
| Target Synonyms | 2A9; PRA; 5B10; CABP; CACY; S10A6; A6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse lung, Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human S100A6 (NP_055439.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG | Uniprot ID | P06703 |
Uniprot Id
P06703
Target Species
Human
Target Name
S100A6
Target Full Name
Protein S100-A6
Target Function
May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes such as the reorganization of the actin cytoskeleton and in cell motility. Binds 2 calcium ions. Calcium binding is cooperative.
Target Subcellular Location
Nucleus envelope. Cytoplasm. Cell membrane; Peripheral membrane protein; Cytoplasmic side.
Target Protein Families
S-100 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
2A9; 5B10; CABP; CACY; Calcyclin; Growth factor inducible protein 2A9; Growth factor-inducible protein 2A9; MLN 4; MLN4; OTTHUMP00000015472; OTTHUMP00000015473; PRA; PRAGrowth factor inducible protein 2A9; Prolactin receptor associated protein; Prolactin receptor-associated protein; Protein S100 A6; Protein S100-A6; S100 A6; S100 calcium binding protein A6 (calcyclin); S100 calcium binding protein A6; S100 calcium-binding protein A6; S100A6; S10A6_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in stimulation of Ca2+-dependent insulin release, stimulation of prolactin secretion, and exocytosis. Chromosomal rearrangements and altered expression of this gene have been implicated in melanoma.
Notification