Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S1PR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-353 of human S1PR2 (NP_004221.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against S1PR2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 250-353 of human S1PR2 (NP_004221.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01813A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S1PR2 |
| Target Synonyms | EDG5; H218; LPB2; S1P2; AGR16; EDG-5; DFNB68; Gpcr13; S1PR2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 250-353 of human S1PR2 (NP_004221.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVLRPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV | Uniprot ID | O95136 |
Uniprot Id
O95136
Target Species
Human
Target Name
S1PR2
Target Full Name
Sphingosine 1-phosphate receptor 2
Target Function
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effects on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis. Receptor for the chemokine-like protein FAM19A5. Mediates the inhibitory effect of FAM19A5 on vascular smooth muscle cell proliferation and migration.
Target Involvement
Deafness, autosomal recessive, 68 (DFNB68)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Synonyms
S1PR2; EDG5; Sphingosine 1-phosphate receptor 2; S1P receptor 2; S1P2; Endothelial differentiation G-protein coupled receptor 5; Sphingosine 1-phosphate receptor Edg-5; S1P receptor Edg-5
Target Background
This gene encodes a member of the G protein-coupled receptors, as well as the EDG family of proteins. The encoded protein is a receptor for sphingosine 1-phosphate, which participates in cell proliferation, survival, and transcriptional activation. Defects in this gene have been associated with congenital profound deafness.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
