-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against S1PR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human S1PR3 (Q99500) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against S1PR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human S1PR3 (Q99500) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16179A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | S1PR3 |
| Target Synonyms | EDG3; LPB3; S1P3; EDG-3; C9orf47; C9orf108; bA791O21.3; S1PR3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, Mouse lung, Mouse thymus, PC-3, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human S1PR3 (Q99500). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSG | Uniprot ID | Q99500 |
Uniprot Id
Q99500
Target Species
Human
Target Name
S1PR3
Target Full Name
Sphingosine 1-phosphate receptor 3
Target Function
Receptor for the lysosphingolipid sphingosine 1-phosphate (S1P). S1P is a bioactive lysophospholipid that elicits diverse physiological effect on most types of cells and tissues. When expressed in rat HTC4 hepatoma cells, is capable of mediating S1P-induced cell proliferation and suppression of apoptosis.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in all tissues, but most abundantly in heart, placenta, kidney, and liver.
Target Synonyms
S1PR3; EDG3; Sphingosine 1-phosphate receptor 3; S1P receptor 3; S1P3; Endothelial differentiation G-protein coupled receptor 3; Sphingosine 1-phosphate receptor Edg-3; S1P receptor Edg-3
Target Background
This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function.
Notification