Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SAFB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human SAFB (NP_002958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SAFB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human SAFB (NP_002958.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-00111A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SAFB |
| Target Synonyms | HAP; HET; SAF-B; SAFB1; SAB-B1; SAF-B1; SAFB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse spinal cord, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human SAFB (NP_002958.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QPGDGERTDCEPVGLEPAVEQSSAASELAEASSEELAEAPTEAPSPEARDSKEDGRKFDFDACNEVPPAPKESSTSEGADQKMSSPEDDSDTKRLSKEEKG | Uniprot ID | Q15424 |
Uniprot Id
Q15424
Target Species
Human
Target Name
SAFB
Target Full Name
Scaffold attachment factor B1
Target Function
Binds to scaffold/matrix attachment region (S/MAR) DNA and forms a molecular assembly point to allow the formation of a 'transcriptosomal' complex (consisting of SR proteins and RNA polymerase II) coupling transcription and RNA processing. Functions as an estrogen receptor corepressor and can also bind to the HSP27 promoter and decrease its transcription. Thereby acts as a negative regulator of cell proliferation. When associated with RBMX, binds to and stimulates transcription from the SREBF1 promoter.
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Ubiquitous. Expressed at high levels in the CNS and at low levels in the liver. Expressed in a wide number of breast cancer cell lines.
Target Synonyms
DKFZp779C1727; glutathione S transferase fusion protein; HAP; HET; HSP27 ERE TATA binding protein; HSP27 ERE-TATA-binding protein; HSP27 estrogen response element-TATA box-binding protein; SAF B; SAF-B; SAF-B1; SAFB 1; SAFB; SAFB1; SAFB1_HUMAN; Scaffold attachment factor B1
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
