Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SAMM50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human SAMM50 (Q9Y512) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SAMM50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human SAMM50 (Q9Y512) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13449A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SAMM50 |
| Target Synonyms | OMP85; SAM50; TOB55; TRG-3; CGI-51; YNL026W; SAMM50 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, 293T, HepG2, Mouse skeletal muscle, Rat pancreas, RD | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human SAMM50 (Q9Y512). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FELQLNKQLIFDSVFSASFWGGMLVPIGDKPSSIADRFYLGGPTSIRGFSMHSIGPQSEGDYLGGEAYWAGGLHLYTPLPFRPGQGGFGELFRTHFFLNAG | Uniprot ID | Q9Y512 |
Uniprot Id
Q9Y512
Target Species
Human
Target Name
SAMM50
Target Full Name
Sorting and assembly machinery component 50 homolog
Target Function
Plays a crucial role in the maintenance of the structure of mitochondrial cristae and the proper assembly of the mitochondrial respiratory chain complexes. Required for the assembly of TOMM40 into the TOM complex.
Target Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein. Cytoplasm. Mitochondrion.
Target Protein Families
SAM50/omp85 family
Target Synonyms
CGI 51; CGI-51; FLJ35825; FLJ42905; FLJ99036; OMP85; SAM50; SAM50_HUMAN; Samm50; sorting and assembly machinery 50kDa; sorting and assembly machinery component 50 homolog (S. cerevisiae); Sorting and assembly machinery component 50 homolog; sorting and assembly machinery component 50, S. cerevisiae, homolog of; TOB55; Transformation-related gene 3 protein; TRG-3; YNL026W
Target Background
This gene encodes a component of the Sorting and Assembly Machinery (SAM) of the mitochondrial outer membrane. The Sam complex functions in the assembly of beta-barrel proteins into the outer mitochondrial membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
