-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SAP18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-172 of human SAP18 (NP_005861.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SAP18 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 21-172 of human SAP18 (NP_005861.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-03958A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SAP18 |
| Target Synonyms | SAP18P; 2HOR0202; SAP18 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SW480 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 21-172 of human SAP18 (NP_005861.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSGRMRPY | Uniprot ID | O00422 |
Uniprot Id
O00422
Target Species
Human
Target Name
SAP18
Target Full Name
Histone deacetylase complex subunit SAP18
Target Function
Component of the SIN3-repressing complex. Enhances the ability of SIN3-HDAC1-mediated transcriptional repression. When tethered to the promoter, it can direct the formation of a repressive complex to core histone proteins. Auxiliary component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Component of the ASAP and PSAP complexes which bind RNA in a sequence-independent manner and are proposed to be recruited to the EJC prior to or during the splicing process and to regulate specific excision of introns in specific transcription subsets. The ASAP complex can inhibit mRNA processing during in vitro splicing reactions. The ASAP complex promotes apoptosis and is disassembled after induction of apoptosis. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits the formation of proapoptotic isoforms such as Bcl-X(S); the activity is different from the established EJC assembly and function.
Target Subcellular Location
Nucleus. Cytoplasm. Nucleus speckle.
Target Protein Families
SAP18 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
18 kDa Sin3-associated polypeptide; 2HOR0202; Cell growth-inhibiting gene 38 protein; Histone deacetylase complex subunit SAP18; SAP18; SAP18_HUMAN; Sin3-associated polypeptide p18
Target Background
Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2.
Notification