-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SARA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SARA (O95405) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against SARA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human SARA (O95405) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13354A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SARA |
| Target Synonyms | NSP; SARA; MADHIP; SMADIP; PPP1R173 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse testis, Rat lung, Rat testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SARA (O95405). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MENYFQAEAYNLDKVLDEFEQNEDETVSSTLLDTKWNKILDPPSHRLSFNPTLASVNESAVSNESQPQLKVFSLAHSAPLTTEEEDHCANGQDCNLNPEI | Uniprot ID | O95405 |
Uniprot Id
O95405
Target Species
Human
Target Name
ZFYVE9
Target Full Name
Zinc finger FYVE domain-containing protein 9
Target Function
Early endosomal protein that functions to recruit SMAD2/SMAD3 to intracellular membranes and to the TGF-beta receptor. Plays a significant role in TGF-mediated signaling by regulating the subcellular location of SMAD2 and SMAD3 and modulating the transcriptional activity of the SMAD3/SMAD4 complex. Possibly associated with TGF-beta receptor internalization.
Target Subcellular Location
Cytoplasm. Early endosome membrane.
Target Tissue Specificity
Ubiquitous. In the brain found primarily in the cerebrovascular smooth muscle cells and reactive astrocytes.
Target Synonyms
CG15667; hSARA; LD33044p; Madh-interacting protein; MADHIP; Mothers against decapentaplegic homolog-interacting protein; Novel serine protease; NSP; Receptor activation anchor; SAR1; SARA; SARA1; Smad anchor for receptor activation; SMADIP; ZFYV9_HUMAN; ZFYVE9; Zinc finger FYVE domain-containing protein 9
Target Background
This gene encodes a double zinc finger motif-containing protein that participates in the transforming growth factor-beta (TGFB) signalling pathway. The encoded protein interacts directly with SMAD2 and SMAD3, and recruits SMAD2 to the TGFB receptor. There are multiple pseudogenes for this gene on chromosomes 2, 15, and X. Alternative splicing results in multiple transcript variants.
Notification