-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SAT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SAT2 (NP_597998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SAT2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SAT2 (NP_597998.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-02624A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SAT2 |
| Target Synonyms | SSAT2; SSAT-2; SAT2 | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Rat kidney | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human SAT2 (NP_597998.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASVRIREAKEGDCGDILRLIRELAEFEKLSDQVKISEEALRADGFGDNPFYHCLVAEILPAPGKLLGPCVVGYGIYYFIYSTWKGRTIYLEDIYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLAVLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEATRKLAGK | Uniprot ID | Q96F10 |
Uniprot Id
Q96F10
Target Species
Human
Target Name
SAT2
Target Full Name
Thialysine N-epsilon-acetyltransferase
Target Function
Catalyzes the N-acetylation of the amino acid thialysine (S-(2-aminoethyl)-L-cysteine), a L-lysine analog with the 4-methylene group substituted with a sulfur. May also catalyze acetylation of polyamines, such as norspermidine, spermidine or spermine. However, ability to acetylate polyamines is weak, suggesting that it does not act as a diamine acetyltransferase in vivo.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Acetyltransferase family
Target Tissue Specificity
Widely expressed. Under physiological conditions, SSAT2 is expressed at lower level that SSAT1 (SSAT). Many tissues express only SSAT1, several tissues express both SSAT1 and SSAT2, and bone, cervix, ovary and pineal gland expressed only SSAT2.
Target Synonyms
Amino acid transporter A2; ATA2; Diamine acetyltransferase 2; Diamine N acetyltransferase 2; Polyamine N acetyltransferase; Polyamine N-acetyltransferase 2; Protein 40 9 1; SAT2; SAT2_HUMAN; SNAT2; Solute carrier family 38 member 2; Spermidine/spermine N(1)-acetyltransferase 2; Spermidine/spermine N1 acetyltransferase 2; Spermidine/spermine N1 acetyltransferase family member 2; SSAT2; System A amino acid transporter 2; System A transporter 1; System N amino acid transporter 2; Thialysine N-epsilon-acetyltransferase
Target Background
Enables diamine N-acetyltransferase activity and identical protein binding activity. Involved in polyamine metabolic process. Located in extracellular exosome.
Notification