-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SATB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 634-733 of human SATB2 (NP_001165980.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against SATB2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 634-733 of human SATB2 (NP_001165980.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-14219A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SATB2 |
| Target Synonyms | GLSS; DEL2Q32Q33; C2DELq32q33; SATB2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 634-733 of human SATB2 (NP_001165980.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | HDVGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEELLTESEENDSEEGSEEMYKVEAEEENADKSKAAPAEIDQR | Uniprot ID | Q9UPW6 |
Uniprot Id
Q9UPW6
Target Species
Human
Target Name
SATB2
Target Full Name
DNA-binding protein SATB2
Target Function
Binds to DNA, at nuclear matrix- or scaffold-associated regions. Thought to recognize the sugar-phosphate structure of double-stranded DNA. Transcription factor controlling nuclear gene expression, by binding to matrix attachment regions (MARs) of DNA and inducing a local chromatin-loop remodeling. Acts as a docking site for several chromatin remodeling enzymes and also by recruiting corepressors (HDACs) or coactivators (HATs) directly to promoters and enhancers. Required for the initiation of the upper-layer neurons (UL1) specific genetic program and for the inactivation of deep-layer neurons (DL) and UL2 specific genes, probably by modulating BCL11B expression. Repressor of Ctip2 and regulatory determinant of corticocortical connections in the developing cerebral cortex. May play an important role in palate formation. Acts as a molecular node in a transcriptional network regulating skeletal development and osteoblast differentiation.
Target Involvement
Cleft palate isolated (CPI)
Target Subcellular Location
Nucleus matrix.
Target Protein Families
CUT homeobox family
Target Tissue Specificity
High expression in adult brain, moderate expression in fetal brain, and weak expression in adult liver, kidney, and spinal cord and in select brain regions, including amygdala, corpus callosum, caudate nucleus, and hippocampus.
Target Synonyms
DNA binding protein SATB2; DNA-binding protein SATB2; FLJ21474; FLJ32076; GLSS; KIAA1034; MGC119474; MGC119477; SATB family member 2; SATB homeobox 2; SATB2; SATB2_HUMAN; Special AT rich sequence binding protein 2; Special AT-rich sequence-binding protein 2
Target Background
This gene encodes a DNA binding protein that specifically binds nuclear matrix attachment regions. The encoded protein is involved in transcription regulation and chromatin remodeling. Defects in this gene are associated with isolated cleft palate and cognitive disability. Alternate splicing results in multiple transcript variants that encode the same protein.
Notification