Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCAF8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 572-634 of human SCAF8 (NP_055707.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCAF8 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 572-634 of human SCAF8 (NP_055707.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-07246A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCAF8 |
| Target Synonyms | RBM16; SCAF8 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 572-634 of human SCAF8 (NP_055707.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PWEKVKVDDLEGFAEGGMIDQETVNTEWETVKSSEPVKETVQTTQSPTPVEKETVVTTQAEVF | Uniprot ID | Q9UPN6 |
Uniprot Id
Q9UPN6
Target Species
Human
Target Name
SCAF8
Target Full Name
SR-related and CTD-associated factor 8
Target Function
Anti-terminator protein required to prevent early mRNA termination during transcription. Together with SCAF4, acts by suppressing the use of early, alternative poly(A) sites, thereby preventing the accumulation of non-functional truncated proteins. Mechanistically, associates with the phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit (POLR2A), and subsequently binds nascent RNA upstream of early polyadenylation sites to prevent premature mRNA transcript cleavage and polyadenylation. Independently of SCAF4, also acts as a positive regulator of transcript elongation.
Target Subcellular Location
Nucleus. Nucleus matrix.
Target Synonyms
SCAF8; CCAP7; KIAA1116; RBM16; SR-related and CTD-associated factor 8; CDC5L complex-associated protein 7; RNA-binding motif protein 16
Target Background
Enables RNA binding activity and RNA polymerase II C-terminal domain phosphoserine binding activity. Involved in negative regulation of termination of RNA polymerase II transcription, poly(A)-coupled and positive regulation of DNA-templated transcription, elongation. Located in nucleoplasm.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
