-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCN2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 275-401 of human SCN2A (NP_001035232.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCN2A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 275-401 of human SCN2A (NP_001035232.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01638A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCN2A |
| Target Synonyms | EA9; HBA; NAC2; BFIC3; BFIS3; BFNIS; DEE11; HBSCI; EIEE11; HBSCII; Nav1.2; SCN2A1; SCN2A2; Na(v)1.2; SCN2A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 275-401 of human SCN2A (NP_001035232.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTY | Uniprot ID | Q99250 |
Uniprot Id
Q99250
Target Species
Human
Target Name
SCN2A
Target Full Name
Sodium channel protein type 2 subunit alpha
Target Function
Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. Implicated in the regulation of hippocampal replay occurring within sharp wave ripples (SPW-R) important for memory.
Target Involvement
Seizures, benign familial infantile, 3 (BFIS3); Epileptic encephalopathy, early infantile, 11 (EIEE11)
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Sodium channel (TC 1.A.1.10) family, Nav1.2/SCN2A subfamily
Target Synonyms
HBSC II; NAC2; Scn2a; SCN2A_HUMAN; SCN2A1; SCN2A2; Sodium channel protein brain II subunit alpha; Sodium channel protein type 2 subunit alpha; Sodium channel protein type II subunit alpha; Sodium channel protein, brain II subunit alpha; Voltage gated sodium channel subunit alpha Nav1.2; Voltage-gated sodium channel subunit alpha Nav1.2
Target Background
Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with four repeat domains, each of which is composed of six membrane-spanning segments, and one or more regulatory beta subunits. Voltage-gated sodium channels function in the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family. Allelic variants of this gene are associated with seizure disorders and autism spectrum disorder. Alternative splicing results in multiple transcript variants.
Notification