-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCN3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 274-400 of human SCN3A (NP_008853.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SCN3A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 274-400 of human SCN3A (NP_008853.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01235A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCN3A |
| Target Synonyms | NAC3; DEE62; EIEE62; FFEVF4; Nav1.3; SCN3A | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, HT-1080 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 274-400 of human SCN3A (NP_008853.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RNKCLQWPPSDSAFETNTTSYFNGTMDSNGTFVNVTMSTFNWKDYIGDDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTY | Uniprot ID | Q9NY46 |
Uniprot Id
Q9NY46
Target Species
Human
Target Name
SCN3A
Target Full Name
Sodium channel protein type 3 subunit alpha
Target Function
Mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. May contribute to the regulation of serotonin/5-hydroxytryptamine release by enterochromaffin cells. In pancreatic endocrine cells, required for both glucagon and glucose-induced insulin secretion.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
Sodium channel (TC 1.A.1.10) family, Nav1.3/SCN3A subfamily
Target Tissue Specificity
Expressed in enterochromaffin cells in both colon and small bowel (at protein level).
Target Synonyms
brain III voltage-gated sodium channel; NAC3; Nav1.3; SCN3A; SCN3A_HUMAN; Sodium channel protein brain III subunit alpha; Sodium channel protein type 3 subunit alpha; Sodium channel protein type III subunit alpha; Sodium channel protein, brain III subunit alpha; sodium channel, brain type III, alpha subunit; sodium channel, neuronal type III, alpha subunit; sodium channel, voltage-gated, type III, alpha polypeptide; sodium channel, voltage-gated, type III, alpha subunit; Voltage gated sodium channel subtype III; Voltage gated sodium channel subunit alpha Nav1.3; Voltage-gated sodium channel subtype III; Voltage-gated sodium channel subunit alpha Nav1.3
Target Background
Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family, and is found in a cluster of five alpha subunit genes on chromosome 2. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification