-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCN3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-160 of human SCN3B (NP_060870.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SCN3B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 23-160 of human SCN3B (NP_060870.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01414A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCN3B |
| Target Synonyms | SCNB3; ATFB16; BRGDA7; HSA243396; SCN3B | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 23-160 of human SCN3B (NP_060870.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FPVCVEVPSETEAVQGNPMKLRCISCMKREEVEATTVVEWFYRPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFTSVVSEI | Uniprot ID | Q9NY72 |
Uniprot Id
Q9NY72
Target Species
Human
Target Name
SCN3B
Target Full Name
Sodium channel regulatory subunit beta-3
Target Function
Modulates channel gating kinetics. Causes unique persistent sodium currents. Inactivates the sodium channel opening more slowly than the subunit beta-1. Its association with NFASC may target the sodium channels to the nodes of Ranvier of developing axons and retain these channels at the nodes in mature myelinated axons.
Target Involvement
Brugada syndrome 7 (BRGDA7); Atrial fibrillation, familial, 16 (ATFB16)
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Sodium channel auxiliary subunit SCN3B (TC 8.A.17) family
Target Tissue Specificity
Expressed in the atrium.
Target Synonyms
1110001K16Rik; 4833414B02Rik; HSA243396; KIAA1158; MGC136997; MGC80155; Scn3b; SCN3B_HUMAN; SCNB3; Sodium channel subunit beta-3; Sodium channel, beta 3 subunit; sodium channel, voltage-gated, type III, beta
Target Background
Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel beta subunit gene family, and influences the inactivation kinetics of the sodium channel. Two alternatively spliced variants, encoding the same protein, have been identified.
Notification