-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SCNN1G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-289 of human SCNN1G (NP_001030.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SCNN1G was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-289 of human SCNN1G (NP_001030.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-10143A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SCNN1G |
| Target Synonyms | PHA1; BESC3; ENaCg; LDLS2; SCNEG; PHA1B3; ENaCgamma; SCNN1G | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, A549, COS1, COS7, NCI-H460, Rat kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-289 of human SCNN1G (NP_001030.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWNSVSEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHIESKQVVGFQLCSNDTSDCATYTFSSGINAIQEWYKLHYMNIMAQVPLEKKINMS | Uniprot ID | P51170 |
Uniprot Id
P51170
Target Species
Human
Target Name
SCNN1G
Target Full Name
Epithelial sodium channel subunit gamma
Target Function
Sodium permeable non-voltage-sensitive ion channel inhibited by the diuretic amiloride. Mediates the electrodiffusion of the luminal sodium (and water, which follows osmotically) through the apical membrane of epithelial cells. Plays an essential role in electrolyte and blood pressure homeostasis, but also in airway surface liquid homeostasis, which is important for proper clearance of mucus. Controls the reabsorption of sodium in kidney, colon, lung and sweat glands. Also plays a role in taste perception.
Target Involvement
Liddle syndrome (LIDLS); Bronchiectasis with or without elevated sweat chloride 3 (BESC3)
Target Subcellular Location
Apical cell membrane; Multi-pass membrane protein.
Target Protein Families
Amiloride-sensitive sodium channel (TC 1.A.6) family, SCNN1G subfamily
Target Tissue Specificity
Expressed in kidney (at protein level).
Target Synonyms
Amiloride sensitive epithelial sodium channel gamma subunit; Amiloride sensitive sodium channel subunit gamma; Amiloride-sensitive sodium channel subunit gamma; BESC3; ENaC gamma subunit; ENaCG; ENaCgamma; Epithelial Na(+) channel subunit gamma; Epithelial Na+ channel subunit gamma; Gamma ENaC; Gamma NaCH; Gamma-ENaC; Gamma-NaCH; Nonvoltage gated sodium channel 1 subunit gamma; Nonvoltage-gated sodium channel 1 subunit gamma; PHA 1; PHA1; SCNEG; SCNN 1G; SCNN1G; SCNNG_HUMAN; Sodium channel epithelial 1 gamma subunit; Sodium channel non voltage gated 1 gamma subunit; Sodium channel nonvoltage gated 1 gamma
Target Background
Nonvoltage-gated, amiloride-sensitive, sodium channels control fluid and electrolyte transport across epithelia in many organs. These channels are heteromeric complexes consisting of 3 subunits: alpha, beta, and gamma. This gene encodes the gamma subunit, and mutations in this gene have been associated with Liddle syndrome.
Notification