-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SDHB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 181-280 of human SDHB (P21912) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SDHB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 181-280 of human SDHB (P21912) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16639A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SDHB |
| Target Synonyms | IP; SDH; CWS2; PGL4; SDH1; SDH2; SDHIP; MC2DN4; SDHB | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Hep G2, Mouse brain, Mouse liver, Mouse lung, Rat liver, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 181-280 of human SDHB (P21912). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV | Uniprot ID | P21912 |
Uniprot Id
P21912
Target Species
Human
Target Name
SDHB
Target Full Name
Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
Target Function
Iron-sulfur protein (IP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q).
Target Involvement
Pheochromocytoma (PCC); Paragangliomas 4 (PGL4); Paraganglioma and gastric stromal sarcoma (PGGSS); Cowden syndrome 2 (CWS2)
Target Subcellular Location
Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Target Protein Families
Succinate dehydrogenase/fumarate reductase iron-sulfur protein family
Target Synonyms
CWS2; DHSB_HUMAN; FLJ92337; Ip; Iron sulfur subunit; Iron sulfur subunit of complex II; Iron-sulfur subunit of complex II; mitochondrial; PGL 4; PGL4; SDH 1; SDH; SDH1; SDH2; SDH2, homolog of; SdhB; SDHIP; Succinate dehydrogenase [ubiquinone] iron sulfur protein mitochondrial; Succinate dehydrogenase [ubiquinone] iron sulfur subunit; Succinate dehydrogenase [ubiquinone] iron-sulfur subunit; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; Succinate Dehydrogenase 1 Iron Sulfur Subunit; Succinate Dehydrogenase 2, S. cerevisiae, homolog of; Succinate dehydrogenase complex iron sulfur subunit B; Succinate dehydrogenase complex subunit B iron sulfur; Succinate Dehydrogenase Complex Subunit B Iron Sulfur Protein; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); Succinate dehydrogenase iron sulfur protein
Target Background
This tumor suppressor gene encodes the iron-sulfur protein subunit of the succinate dehydrogenase (SDH) enzyme complex which plays a critical role in mitochondria. The SDH enzyme complex is composed of four nuclear-encoded subunits. This enzyme complex converts succinate to fumarate which releases electrons as part of the citric acid cycle, and the enzyme complex additionally provides an attachment site for released electrons to be transferred to the oxidative phosphorylation pathway. The SDH enzyme complex plays a role in oxygen-related gene regulation through its conversion of succinate, which is an oxygen sensor that stabilizes the hypoxia-inducible factor 1 (HIF1) transcription factor. Sporadic and familial mutations in this gene result in paragangliomas, pheochromocytoma, and gastrointestinal stromal tumors, supporting a link between mitochondrial dysfunction and tumorigenesis. Mutations in this gene are also implicated in nuclear type 4 mitochondrial complex II deficiency.
Notification