Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEC22B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-195 of human SEC22B (NP_004883.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against SEC22B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 85-195 of human SEC22B (NP_004883.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05114A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC22B |
| Target Synonyms | ERS-24; SEC22L1; SEC22B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-431, LO2, Mouse brain, Mouse thymus | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 85-195 of human SEC22B (NP_004883.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | FAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAK | Uniprot ID | O75396 |
Uniprot Id
O75396
Target Species
Human
Target Name
SEC22B
Target Full Name
Vesicle-trafficking protein SEC22b
Target Function
SNARE involved in targeting and fusion of ER-derived transport vesicles with the Golgi complex as well as Golgi-derived retrograde transport vesicles with the ER.
Target Subcellular Location
Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus, cis-Golgi network membrane. Golgi apparatus, trans-Golgi network membrane. Melanosome.
Target Protein Families
Synaptobrevin family
Target Synonyms
SEC22B; SEC22L1; Vesicle-trafficking protein SEC22b; ER-Golgi SNARE of 24 kDa; ERS-24; ERS24; SEC22 vesicle-trafficking protein homolog B; SEC22 vesicle-trafficking protein-like 1
Target Background
The protein encoded by this gene is a member of the SEC22 family of vesicle trafficking proteins. It seems to complex with SNARE and it is thought to play a role in the ER-Golgi protein trafficking. This protein has strong similarity to Mus musculus and Cricetulus griseus proteins.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
