-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Sec23A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Sec23A (NP_006355.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Sec23A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Sec23A (NP_006355.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09261A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC23A |
| Target Synonyms | CLSD; hSec23A; Sec23A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, B cells, HT-29, LO2, Mouse brain, Mouse liver, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human Sec23A (NP_006355.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTTYLEFIQQNEERDGVRFSWNVWPSSRLEATRMVVPVAALFTPLKERPDLPPIQYEPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPAELLPQFSSIEYVVLRGPQMPLIFLYVVDTCMEDEDLQALKES | Uniprot ID | Q15436 |
Uniprot Id
Q15436
Target Species
Human
Target Name
SEC23A
Target Full Name
Protein transport protein Sec23A
Target Function
Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules for their transport to the Golgi complex. Required for the translocation of insulin-induced glucose transporter SLC2A4/GLUT4 to the cell membrane.
Target Involvement
Craniolenticulosutural dysplasia (CLSD)
Target Subcellular Location
Cytoplasmic vesicle, COPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol.
Target Protein Families
SEC23/SEC24 family, SEC23 subfamily
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
CLSD; Protein transport protein Sec23A; SC23A_HUMAN; Sec23 homolog A (S. cerevisiae); SEC23-related protein A; sec23a
Target Background
The protein encoded by this gene is a member of the SEC23 subfamily of the SEC23/SEC24 family. It is part of a protein complex and found in the ribosome-free transitional face of the endoplasmic reticulum (ER) and associated vesicles. This protein has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The encoded protein is suggested to play a role in the ER-Golgi protein trafficking.
Notification