-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SEC24C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 915-1094 of human SEC24C (NP_004913.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against SEC24C was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 915-1094 of human SEC24C (NP_004913.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01697A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SEC24C |
| Target Synonyms | SEC24C | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, SKOV3 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 915-1094 of human SEC24C (NP_004913.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DVLQPGAEVTTDDRAYVRQLVTSMDVTETNVFFYPRLLPLTKSPVESTTEPPAVRASEERLSNGDIYLLENGLNLFLWVGASVQQGVVQSLFSVSSFSQITSGLSVLPVLDNPLSKKVRGLIDSLRAQRSRYMKLTVVKQEDKMEMLFKHFLVEDKSLSGGASYVDFLCHMHKEIRQLLS | Uniprot ID | P53992 |
Uniprot Id
P53992
Target Species
Human
Target Name
SEC24C
Target Full Name
Protein transport protein Sec24C
Target Function
Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules for their transport to the Golgi complex. Plays a central role in cargo selection within the COPII complex and together with SEC24D may have a different specificity compared to SEC24A and SEC24B. May more specifically package GPI-anchored proteins through the cargo receptor TMED10. May also be specific for IxM motif-containing cargos like the SNAREs GOSR2 and STX5.
Target Subcellular Location
Cytoplasmic vesicle, COPII-coated vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endoplasmic reticulum membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cytosol.
Target Protein Families
SEC23/SEC24 family, SEC24 subfamily
Target Tissue Specificity
Ubiquitous.
Target Synonyms
Protein transport protein Sec24C; SC 24C; SC24 C; SC24C; SC24C_HUMAN; Sec 24C; Sec24 C; SEC24 related gene family, member C (S. cerevisiae); SEC24 related protein C; SEC24-related protein C; SEC24C
Target Background
The protein encoded by this gene is a member of the SEC24 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. The encoded protein has similarity to yeast Sec24p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The product of this gene may play a role in shaping the vesicle, as well as in cargo selection and concentration. Alternatively spliced transcript variants encoding the same protein have been identified.
Notification